Cat: PA1000-9210

Recombinant Human CA6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CA6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CA6;C1orf149;CENP-28;EAF6;Chromatin modification-related Protein MEAF6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P23280

  • Expression Region

    18-308aa

  • AA Sequence

    QHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN

  • Molecular Weight

    41.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CA6, or carbonic anhydrase 6, is a member of the carbonic anhydrase enzyme family that plays a crucial role in regulating pH and bicarbonate levels in biological systems. This enzyme is primarily expressed in the salivary glands and is involved in various physiological processes, including salivary bicarbonate secretion, which contributes to the maintenance of oral health. Recent studies have highlighted the significance of CA6 in various pathological conditions, such as autoimmune diseases and oral cancers, suggesting that alterations in its expression or activity may influence disease progression. Given its potential as a biomarker and therapeutic target, researchers have focused on recombinant CA6 proteins to explore their biochemical properties and interactions. The production of recombinant CA6 allows for detailed functional studies, including enzyme kinetics, substrate specificity, and structural analyses through techniques like X-ray crystallography. Understanding the molecular mechanisms underlying CA6 function and its role in disease can pave the way for developing novel diagnostic and therapeutic strategies. Furthermore, research into CA6 is also essential for exploring its evolutionary significance and functional diversity among different species, thereby contributing to a broader understanding of carbonic anhydrases in health and disease. Overall, the investigation of CA6 and its recombinant protein holds promise not only for advancing scientific knowledge but also for improving clinical outcomes in related health issues.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US