Cat: IPD-X50109

Recombinant Mouse FBXW8 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FBXW8

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    F box and WD40 domain containing protein 8; F box only protein 29; F box/WD repeat containing protein 8; F-box and WD-40 domain-containing protein 8; F-box only protein 29; F-box/WD repeat-containing protein 8; FBW6; FBW8; FBX29; FBXO29; FBXW6; FBXW8; FBXW8_HUMAN

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-terminal His Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8BIA4

  • Expression Region

    1-400aa

  • AA Sequence

    MDDHNLEEFRRHWQEELAQSQALRRRRRLEAGERRSPRRPEAGARGEPASGYLG LAQGLLEGAGRPPAPRPGRGGDRKDTSSRSRSPPDRDATEPEPLVDQLIRDLNE LDDVPFFDVRLPYELAINIFQYLNRRELGLCAQVSKTWKVIAEDEVLWYRLCRQ EGHLPHSRFSDYTCWKLILQECLAKEHTLRANWKNRKGAVSELEHVPDAVLCDV RSHDGVVIAGYTSGDVRVWDTRTWDYVAPFLESESEEEDPGMQPYVSFVRINSS LAVAAYEDGILNIWDLRTGRFPIFRFEHDARIQALALSQEKPIVATASAFDVVM LYPNEEGHWHVASEFEVQKLVDYLEIVPNTGRYPVAIATAGDLVYLLKADDSAR TLHYVYGQPATCLDVSASQVAF

  • Molecular Weight

    48.9kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FBXW8 is a member of the F-box protein family, which plays a crucial role in the ubiquitin-proteasome pathway, a key mechanism for protein degradation and regulation within cells. Emerging research indicates that FBXW8 is involved in various cellular processes, including cell cycle regulation, signal transduction, and apoptosis. Dysregulation of FBXW8 expression has been linked to several diseases, especially cancer, where it may contribute to the stabilization of oncogenic proteins or the degradation of tumor suppressors. Furthermore, studies have shown that FBXW8 can influence immune responses and has potential implications in autoimmune conditions. Given its role in critical cellular functions and disease states, understanding the molecular mechanisms of FBXW8, including its interaction partners and regulatory pathways, is essential for identifying novel therapeutic targets and developing strategies for intervention. This makes FBXW8 a compelling subject of study within the fields of cancer biology, immunology, and cell biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US