Analytical Data
-
Gene name
ZNF658
- Application
-
Alternative Names
ZNF658Zinc finger Protein 658
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5TYW1
-
Expression Region
1-615 aa
-
AA Sequence
MSQASVSFQDVTVEFTREEWQHLGPVERTLYRDVMLENYSHLISVGYCITKPKVISKLEKGEEPWSLEDEFLNQRYPGYFKVDHIKGIREKQEKPLWQEIFISDADKTLSKEGQKVLEKPFNLEIAPELSEKISCKCDSHRMNLPVASQLIISERKYSRKKTEYMNVCEKLQLDIKHEKAHAEEKSYEHGENAKAFSYKKDQHWKFQTLEESFECDGSGQGLYDKTICITPQSFLTGEKSCKDDEFRKNFDKITLFNHMRTDTRGKCSDLNEYGTSCDKTTAVEYNKVHMAMTHYECNERGINFSRKSPLTQSQRTITGWSAFESNKCEENFSQSSAHIVHQKTQAGDKFGEHNECTDALYQKLDFTAHQRIHTEDKFYLSDEHGKCRKSFYRKAHLIQHQRPHSGEKTYQYEECAKSFCSSSHPIQHPGTYVGFKLYECNECGKAFCQNSNLSKHLRIHTKEKPCDNNGCGRSYKSPLIGHQKTDAEMELCGGSEYGKTSHLKGHQRILMGEKPYECIECGKTFSKTSHLRAHQRIHTGEKPYECVECEKTFSHKTHLSVHQRVHTGEKPYECNDCGKSFTYNSALRAHQRIHTGLAVCHVGILMATKSLFHQS
-
Molecular Weight
97.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF658, a member of the zinc finger protein family, plays a significant role in various biological processes, including gene regulation, cell differentiation, and immune responses. The study of ZNF658 has garnered attention due to its potential implications in developmental disorders and diseases, particularly those involving the immune system and cancer. Previous research indicates that ZNF658 may function as a transcription factor, with the ability to bind to specific DNA sequences and modulate the expression of target genes. Furthermore, its expression patterns and interactions with other proteins suggest that ZNF658 could be involved in complex regulatory networks. Recent advancements in recombinant protein technology have enabled the production of ZNF658 in heterologous systems, allowing for detailed structural and functional characterization. This recombinant ZNF658 can be used to investigate its binding affinities, identify interaction partners, and elucidate its role in cellular pathways. Understanding the molecular mechanisms underlying ZNF658's function could provide valuable insights into its biological significance and potential therapeutic applications. Ongoing studies aim to establish the functional relevance of ZNF658 in various contexts, with the hope of uncovering novel strategies for disease intervention and management.
