Analytical Data
-
Gene name
GDF8
- Application
-
Alternative Names
MSTN. GDF8
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14793
-
Expression Region
1-375aa
-
AA Sequence
MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
-
Molecular Weight
69.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GDF8, also known as myostatin, is a member of the transforming growth factor-beta (TGF-β) superfamily and plays a critical role in the regulation of skeletal muscle growth and development. Initially identified in cattle as a gene responsible for muscle hypertrophy when mutated, GDF8's importance has been extensively studied in both animal models and humans. Myostatin acts primarily as a negative regulator of muscle mass, inhibiting myoblast proliferation and differentiation, and thereby controlling muscle fiber development and growth. Understanding the mechanisms through which GDF8 operates has significant implications for muscle-wasting diseases, obesity, and age-related muscle loss. The recombinant form of GDF8 is increasingly being utilized in research to investigate its signaling pathways and interactions in various cellular contexts. It has the potential to serve as a therapeutic target for conditions characterized by muscle atrophy, such as muscular dystrophies and cachexia. Recent advancements in recombinant protein production have allowed for the generation of high-purity GDF8, facilitating detailed biochemical assays and in vivo studies. Researchers are exploring strategies to modulate GDF8 activity, aiming to enhance muscle regeneration and overall metabolic health. The ongoing research into GDF8 and its recombinant protein could provide groundbreaking insights into muscle biology and innovative therapeutic approaches for muscle-related disorders.
