Analytical Data
-
Gene name
GDAP1
- Application
-
Alternative Names
GDAP1; Ganglioside-induced differentiation-associated protein 1; GDAP1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TB36
-
Expression Region
1-290aa
-
AA Sequence
MRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF
-
Molecular Weight
57.64 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GDAP1 (Ganglioside-induced differentiation-associated protein 1) is a member of the mitochondrial protein family implicated in the regulation of mitochondrial dynamics, including fission and fusion processes. It plays a critical role in neuronal health, and mutations in the GDAP1 gene have been linked to several neurodegenerative disorders, particularly Charcot-Marie-Tooth disease (CMT), a hereditary neuropathy characterized by muscle weakness and atrophy. Research into GDAP1 has gained momentum due to its potential as a biomarker for these diseases and a target for therapeutic interventions. The recombinant expression of GDAP1 offers insights into its biological functions and interactions within the mitochondria, facilitating a deeper understanding of the molecular mechanisms underlying mitochondrial pathology. By producing GDAP1 as a recombinant protein, researchers can analyze its structure-function relationship, assess how mutations affect its behavior, and explore its role in mitochondrial defects. This approach not only enhances our comprehension of GDAP1’s contribution to neuronal integrity but also paves the way for developing targeted therapies aimed at mitigating the effects of GDAP1-related neuropathies. Overall, GDAP1 research underscores the intricate relationship between mitochondrial dynamics and neurodegenerative diseases, highlighting the need for continued exploration into its functional properties and the therapeutic possibilities they may offer.
