Analytical Data
-
Gene name
GJA4
- Application
-
Alternative Names
GJA4; Gap junction alpha-4 protein; Connexin-37; Cx37
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35212
-
Expression Region
1-333aa
-
AA Sequence
MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV
-
Molecular Weight
63.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GJA4, also known as Connexin 37, is a member of the connexin family of proteins that form gap junctions, facilitating intercellular communication in various tissues. Research into GJA4 has gained significant attention due to its crucial role in cardiovascular health, particularly in endothelial function and vascular homeostasis. Mutations or dysregulation of GJA4 have been implicated in various cardiovascular diseases, including hypertension and atherosclerosis. Moreover, studies have suggested that GJA4 may influence cellular responses to stress and injury, further highlighting its importance in maintaining cellular integrity. Understanding the structure-function relationship of GJA4 is essential for deciphering its specific roles in different tissues and disease processes. Recent advances in recombinant protein technology have paved the way for the production of GJA4 in a controlled environment, allowing researchers to study its properties in detail. This has led to significant insights into its oligomerization, channel-forming abilities, and interaction with other proteins, supporting the notion that GJA4 is integral to vascular biology. Overall, the exploration of GJA4 and its recombinant forms holds promise for therapeutic interventions aimed at mitigating cardiovascular diseases and enhancing vascular health.
