Cat: PA2000-7923

Recombinant Human GCNT3 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GCNT3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GCNT3; Beta-1.3-galactosyl-O-glycosyl-glycoprotein beta-1.6-N-acetylglucosaminyltransferase 3; C2GnT-mucin type; C2GnT-M; hC2GnT-M; Core 2/core 4 beta-1.6-N-acetylglucosaminyltransferase; C2/4GnT

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95395

  • Expression Region

    28-126aa

  • AA Sequence

    KLSFRLKCDSDHLGLESRESQSQYCRNILYNFLKLPAKRSINCSGVTRGDQEAVLQAILNNLEVKKKREPFTDTHYLSLTRDCEHFKAERKFIQFPLSK

  • Molecular Weight

    36.63 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GCNT3 (Group 3 Glycosyltransferase 6) is a member of the glycosyltransferase family that plays a critical role in the biosynthesis of glycoproteins and glycolipids, influencing various biological processes such as cell adhesion, signaling, and immune response. The enzyme specifically catalyzes the addition of glycan structures to the antigen Kamino to form the Lewis X structure, which is vital for cell-cell interactions and recognition in physiological and pathological contexts. Aberrant expression of GCNT3 has been associated with several diseases, including cancer, where altered glycosylation patterns can contribute to tumor progression and metastasis. Understanding the biochemical properties and functional implications of GCNT3 is crucial for revealing its potential as a biomarker or therapeutic target. Recombinant GCNT3 protein can be produced to facilitate detailed studies of its enzymatic activity, substrate specificity, and interaction with other cellular components. This research aims to elucidate the molecular mechanisms underlying its role in glycosylation pathways and their impact on cellular behavior, thus contributing to the broader field of glycobiology and its application in disease diagnosis and treatment strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US