Analytical Data
-
Gene name
LTBP2
- Application
-
Alternative Names
Ltbp2Latent-transforming growth factor beta-binding protein 2; LTBP-2
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O08999
-
Expression Region
878-1083aa
-
AA Sequence
DDNECMRNPCEGRGRCVNSVGSYSCLCYPGYTLVTLGDTQECQDIDECEQPGVCSGGRCSNTEGSYHCECDRGYIMRKGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEGYVGQSGSCVDVNECLTPGICTHGRCINMEGSFRCSCEPGYEVTPDKKGCRDVDECASRASCPTGLCLNTEGSFTCSACQSGYWVNEDGTACE
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Long-Term Brain Protection Protein 2 (LTBP2) is a member of the latent transforming growth factor-beta (TGF-β) binding protein family, which plays a crucial role in the regulation and stabilization of TGF-β. Research into LTBP2 has gained momentum due to its involvement in various physiological processes, including extracellular matrix organization, tissue repair, and cellular signaling. Abnormalities in LTBP2 expression and function have been linked to several pathologies, particularly those affecting the cardiovascular system and skeletal development. For instance, mutations in the LTBP2 gene have been associated with conditions such as Marfan syndrome-like features and ocular deficiencies. Understanding LTBP2’s structural and functional properties could provide insights into its potential roles in disease mechanisms and therapeutic applications. Moreover, recombinant LTBP2 proteins are being explored for their roles in modulating TGF-β activity and could serve as valuable tools for elucidating the complexities of TGF-β signaling pathways in both health and disease. Consequently, research on LTBP2 is not only pivotal for basic science but also holds promise for the development of innovative strategies for treating related disorders, making it an intriguing target for further investigation in the fields of molecular biology, genetics, and regenerative medicine.
