Cat: PA3000-1108

Recombinant Mouse LTBP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LTBP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Ltbp2Latent-transforming growth factor beta-binding protein 2; LTBP-2

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O08999

  • Expression Region

    878-1083aa

  • AA Sequence

    DDNECMRNPCEGRGRCVNSVGSYSCLCYPGYTLVTLGDTQECQDIDECEQPGVCSGGRCSNTEGSYHCECDRGYIMRKGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEGYVGQSGSCVDVNECLTPGICTHGRCINMEGSFRCSCEPGYEVTPDKKGCRDVDECASRASCPTGLCLNTEGSFTCSACQSGYWVNEDGTACE

  • Molecular Weight

    29 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Long-Term Brain Protection Protein 2 (LTBP2) is a member of the latent transforming growth factor-beta (TGF-β) binding protein family, which plays a crucial role in the regulation and stabilization of TGF-β. Research into LTBP2 has gained momentum due to its involvement in various physiological processes, including extracellular matrix organization, tissue repair, and cellular signaling. Abnormalities in LTBP2 expression and function have been linked to several pathologies, particularly those affecting the cardiovascular system and skeletal development. For instance, mutations in the LTBP2 gene have been associated with conditions such as Marfan syndrome-like features and ocular deficiencies. Understanding LTBP2’s structural and functional properties could provide insights into its potential roles in disease mechanisms and therapeutic applications. Moreover, recombinant LTBP2 proteins are being explored for their roles in modulating TGF-β activity and could serve as valuable tools for elucidating the complexities of TGF-β signaling pathways in both health and disease. Consequently, research on LTBP2 is not only pivotal for basic science but also holds promise for the development of innovative strategies for treating related disorders, making it an intriguing target for further investigation in the fields of molecular biology, genetics, and regenerative medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US