Cat: PA1000-8826

Recombinant Human PS2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PS2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PS2;BCEI;PS2;Trefoil factor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P04155

  • Expression Region

    25-84aa

  • AA Sequence

    EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

  • Molecular Weight

    33.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of PS2 (Presenilin 2) recombinant proteins has gained significant attention in the field of neuroscience and Alzheimer's disease research. PS2 is a crucial component of the gamma-secretase complex, which is responsible for the proteolytic processing of Amyloid Precursor Protein (APP) into amyloid-beta peptides. Abnormal accumulation of these peptides is a hallmark of Alzheimer's disease, making PS2 a critical factor in understanding the disease's pathogenesis. Mutations in the PS2 gene have been linked to familial Alzheimer’s disease, highlighting its role in familial forms of the disorder. Research on recombinant PS2 proteins enables scientists to investigate their structure, function, and interactions with other proteins within the gamma-secretase complex. This research provides insights into the molecular mechanisms underlying Alzheimer's disease, offering potential targets for therapeutic interventions aimed at modulating amyloid-beta production. Additionally, understanding the post-translational modifications of PS2 can shed light on its regulatory mechanisms and influence on gamma-secretase activity. Overall, the investigation of recombinant PS2 proteins is vital for unveiling the complexities of Alzheimer's disease and advancing the development of effective treatments.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US