Analytical Data
-
Gene name
46299.0
- Application
-
Alternative Names
Pou5f1; Oct-3; Oct-4; Otf-3
-
Species
Mouse
-
Source
E. coli
-
Tag
N-terminal His and TRxA Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20263
-
Expression Region
1-352aa
-
AA Sequence
MAGHLASDFAFSPPPGGGDGSAGLEPGWVDPRTWLSFQGPPGGPGIGPGSEVLG ISPCPPAYEFCGGMAYCGPQVGLGLVPQVGVETLQPEGQAGARVESNSEGTSSE PCADRPNAVKLEKVEPTPEESQDMKALQKELEQFAKLLKQKRITLGYTQADVGL TLGVLFGKVFSQTTICRFEALQLSLKNMCKLRPLLEKWVEEADNNENLQEICKS ETLVQARKRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEKDVVRVW FCNRRQKGKRSSIEYSQREEYEATGTPFPGGAVSFPLPPGPHFGTPGYGSPHFT TLYSVPFPEGEAFPSVPVTALGSPMHSN
-
Molecular Weight
41.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of recombinant protein 46299 primarily centers on its potential applications in biotechnology and medicine. This protein, which is derived from a specific sequence in a genetically engineered organism, has garnered attention due to its unique structural and functional properties. Research indicates that 46299 may play a crucial role in various biological processes, including enzyme activity, cellular signaling pathways, and potential therapeutic effects. The interest in this recombinant protein stems from its ability to be produced in a controlled environment, allowing for large-scale production and purification essential for further studies. Moreover, understanding the mechanisms by which 46299 interacts with other cellular components could reveal insights into disease states and lead to the development of novel treatments. Given the ongoing advancements in protein engineering and expression technologies, studying 46299 not only contributes to basic biological knowledge but also holds promise for innovations in drug design and synthetic biology. Thus, the exploration of recombinant protein 46299 stands at the intersection of fundamental research and practical application, making it a significant focus within the fields of molecular biology and biotechnology.
