Analytical Data
-
Gene name
PSEN1
- Application
-
Alternative Names
PSEN1；Presenilin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49768
-
Expression Region
280-379aa
-
AA Sequence
PALIYSSTMVWLVNMAEGDPEAQRRVSKNSKYNAESTERESQDTVAENDD GGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGL
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSEN1, or Presenilin-1, is a crucial protein implicated in the pathogenesis of familial Alzheimer's disease (FAD). It forms a part of the gamma-secretase complex, an enzyme responsible for the cleavage of amyloid precursor protein (APP), leading to the production of beta-amyloid peptides. Mutations in the PSEN1 gene are associated with early-onset Alzheimer's, making it a key target for research into disease mechanisms and potential therapeutic strategies. Studies have revealed that PSEN1 mutations can alter gamma-secretase activity, impacting amyloid beta generation and contributing to neurodegeneration. Understanding the structure and function of PSEN1 is essential for developing targeted treatments. Recent advancements in recombinant protein technologies have enabled the production of PSEN1 in various systems, allowing researchers to analyze its biochemical properties, interactions with other cellular components, and role in cellular signaling pathways. By obtaining PSEN1 as a recombinant protein, scientists can conduct detailed studies on the molecular basis of Alzheimer's disease, explore the effects of specific mutations, and assess the efficacy of potential drug candidates aimed at modulating gamma-secretase activity. As research continues to unfold, PSEN1 remains a focal point in unraveling the complexities of Alzheimer’s disease and developing innovative approaches for intervention.
