Analytical Data
-
Gene name
APOO
- Application
-
Alternative Names
APOO；FAM121B；MIC23；MIC26；MICOS complex subunit MIC26
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BUR5
-
Expression Region
1-198aa
-
AA Sequence
MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHYCEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK
-
Molecular Weight
22.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APOO (apolipoprotein O) is a member of the apolipoprotein family, which plays a significant role in lipid metabolism and transport. Research into APOO has gained traction due to its potential implications in various metabolic disorders, including obesity, diabetes, and cardiovascular diseases. Recent studies have suggested that APOO is involved in the regulation of lipid homeostasis and may influence the development of atherosclerosis. Given its potential as a biomarker for metabolic diseases, the recombinant expression of APOO has become an important area of investigation. By producing recombinant APOO protein, researchers aim to elucidate its structural properties, functional mechanisms, and interactions with other proteins and lipids in the bloodstream. This work not only enhances our understanding of APOO's biological role but also offers insights for therapeutic targeting in disorders linked to lipid metabolism. Overall, the study of recombinant APOO protein is paving the way for new avenues in the diagnosis and treatment of metabolic diseases.
