Cat: PA3000-1082

Recombinant Mouse GATA2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GATA2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Gata2Endothelial transcription factor GATA-2

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-terminal His and TRxA Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O09100

  • Expression Region

    1-480aa

  • AA Sequence

    MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDS QGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAA AAHHHSPWTVSPFSKTPLHPSAAGAPGGPLSVYPGAAGGSGGGSGSSVASLTPT AAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSVARGEDKDGVKYQVS LSESMKMEGGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYGSSLFHPGGF LGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHK MNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYK LHNVNRPLTMKKEGIQTRNRKMSSKSKKSKKGAECFEELSKCMQEKSPPFSAAA LAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG

  • Molecular Weight

    65.5kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GATA2 is a transcription factor that plays a crucial role in hematopoiesis and the development of various tissues, including the immune system. Mutations in the GATA2 gene have been linked to a range of immunodeficiencies and hematological disorders, such as myelodysplastic syndromes and acute myeloid leukemia. Research on GATA2 recombinant proteins has gained significance in understanding its functional mechanisms and the regulatory pathways it governs. By producing recombinant GATA2 protein, researchers can explore its binding affinity to DNA, identify target genes, and elucidate its interactions with other transcription factors and cofactors. This understanding can shed light on how GATA2 mutations lead to disease and potentially uncover new therapeutic targets. Additionally, the development of GATA2-based recombinant proteins may facilitate novel approaches in gene therapy and regenerative medicine. Given the protein's pivotal role in cellular processes, comprehensive studies on its function and structure can provide insights into the molecular basis of blood disorders and foster advancements in targeted treatments. The ongoing research in this field not only promises to enhance our understanding of GATA2's physiological roles but also holds the potential for significant clinical implications in addressing GATA2-related pathologies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US