Cat: PA3000-1074

Recombinant Mouse TLR4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TLR4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Tlr4; Lps; Toll-like receptor 4; EC 3.2.2.6

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-terminal His-Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9QUK6

  • Expression Region

    26-269aa

  • AA Sequence

    NPCIEVVPNITYQCMDQKLSKVPDDIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHH LSNLILTGNPIQSFSPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHV DLSYNYIQTITVNDLQFLRENPQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHR LILGEFKDERNLE

  • Molecular Weight

    32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Toll-like receptor 4 (TLR4) is a crucial component of the innate immune system, playing a significant role in identifying and responding to pathogens. It recognizes pathogen-associated molecular patterns (PAMPs) such as lipopolysaccharides (LPS) found on the surface of gram-negative bacteria. The activation of TLR4 leads to a cascade of immune responses, including the production of pro-inflammatory cytokines and the activation of adaptive immunity, which are vital for host defense mechanisms. Research on TLR4 has gained prominence due to its implications in various diseases, including sepsis, autoimmune disorders, and cancer. The recombinant TLR4 protein has emerged as a valuable tool for studying its signaling pathways and interactions with other immune components. By utilizing recombinant TLR4, scientists can investigate the receptor's structure-function relationship, screen for small molecule inhibitors, and develop therapeutic strategies that modulate TLR4 signaling. Furthermore, exploring TLR4's role in chronic inflammatory conditions may lead to novel treatment approaches. Overall, the study of recombinant TLR4 protein not only enhances our understanding of innate immunity but also paves the way for innovative therapeutic interventions against infectious and inflammatory diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US