Analytical Data
-
Gene name
TLR4
- Application
-
Alternative Names
Tlr4; Lps; Toll-like receptor 4; EC 3.2.2.6
-
Species
Mouse
-
Source
E. coli
-
Tag
N-terminal His-Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9QUK6
-
Expression Region
26-269aa
-
AA Sequence
NPCIEVVPNITYQCMDQKLSKVPDDIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHH LSNLILTGNPIQSFSPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHV DLSYNYIQTITVNDLQFLRENPQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHR LILGEFKDERNLE
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Toll-like receptor 4 (TLR4) is a crucial component of the innate immune system, playing a significant role in identifying and responding to pathogens. It recognizes pathogen-associated molecular patterns (PAMPs) such as lipopolysaccharides (LPS) found on the surface of gram-negative bacteria. The activation of TLR4 leads to a cascade of immune responses, including the production of pro-inflammatory cytokines and the activation of adaptive immunity, which are vital for host defense mechanisms. Research on TLR4 has gained prominence due to its implications in various diseases, including sepsis, autoimmune disorders, and cancer. The recombinant TLR4 protein has emerged as a valuable tool for studying its signaling pathways and interactions with other immune components. By utilizing recombinant TLR4, scientists can investigate the receptor's structure-function relationship, screen for small molecule inhibitors, and develop therapeutic strategies that modulate TLR4 signaling. Furthermore, exploring TLR4's role in chronic inflammatory conditions may lead to novel treatment approaches. Overall, the study of recombinant TLR4 protein not only enhances our understanding of innate immunity but also paves the way for innovative therapeutic interventions against infectious and inflammatory diseases.
