Analytical Data
-
Gene name
Cd209a
- Application
-
Alternative Names
Cd209a; CireCD209 antigen-like protein A
-
Species
Mouse
-
Source
E. coli
-
Tag
N-terminal His and TRxA Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q91ZX1
-
Expression Region
73-238aa
-
AA Sequence
VKVYKIPSSQEENNQMNVYQELTQLKAGVDRLCRSCPWDWTHFQGSCYFFSVAQ KSWNDSATACHNVGAQLVVIKSDEEQNFLQQTSKKRGYTWMGLIDMSKESTWYW VDGSPLTLSFMKYWSKGEPNNLGEEDCAEFRDDGWNDTKCTNKKFWICKKLSTS CPSK
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD209a, also known as DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin), is a C-type lectin receptor primarily expressed on dendritic cells and certain other immune cells. It plays a critical role in the immune response by recognizing and binding to a variety of pathogens, including viruses, bacteria, and fungi. Research surrounding CD209a has gained significant attention due to its involvement in both pathogen recognition and immune regulation. Its unique ability to modulate T-cell responses makes it a potential target for vaccine development and immunotherapy. Additionally, CD209a's interactions with HIV and other viruses underline its significance in the pathogenesis of infectious diseases. The study of recombinant CD209a protein has become paramount for exploring its structural and functional characteristics, aiding in the understanding of its role in immune interactions. This research not only contributes to basic immunology but also holds promise for innovative therapeutic strategies targeting infectious and inflammatory diseases. The development of recombinant forms of CD209a allows for detailed investigations into its binding properties, signaling mechanisms, and potential applications in drug delivery systems and vaccine design, thereby making it a valuable focus in both basic and applied biomedical research.
