Analytical Data
-
Gene name
APOB100
- Application
-
Alternative Names
APOB100；ApolipoProtein B-100
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04114
-
Expression Region
1406-1606aa
-
AA Sequence
NPVSKGLLIFDASSSWGPQMSASVHLDSKKKQHLFVKEVKIDGQFRVSSF YAKGTYGLSCQRDPNTGRLNGESNLRFNSSYLQGTNQITGRYEDGTLSLT STSDLQSGIIKNTASLKYENYELTLKSDTNGKYKNFATSNKMDMTFSKQN ALLRSEYQADY
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Apolipoprotein B100 (APOB100) is a critical protein involved in lipid metabolism and is the primary apolipoprotein of low-density lipoproteins (LDLs), which play a significant role in cholesterol transport and cardiovascular disease. Research into APOB100 has gained substantial attention due to its implications in atherosclerosis and lipid disorders. Its structure and function are essential for understanding the mechanisms of lipid transport, receptor interactions, and the pathophysiology of cardiovascular diseases. Recombinant APOB100 proteins have been developed to study these processes in detail, providing insight into how alterations in lipid profiles can lead to cardiovascular complications. These recombinant proteins can be used in various experimental approaches, including studying protein-lipid interactions, evaluating the efficacy of LDL in cellular uptake, and assessing therapeutic interventions aimed at lipid regulation. Moreover, understanding the regulatory mechanisms governing APOB100 expression and secretion can lead to novel strategies for managing hyperlipidemia and atherosclerosis. Overall, the study of recombinant APOB100 protein serves as a crucial avenue in cardiovascular research, contributing to the development of diagnostic and therapeutic tools for managing heart disease.
