Analytical Data
-
Gene name
APOC1
- Application
-
Alternative Names
APOC1；ApolipoProtein C-I
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02654
-
Expression Region
27-83aa
-
AA Sequence
TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
-
Molecular Weight
22.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APOC1, or Apolipoprotein C1, is a crucial protein involved in lipid metabolism, primarily associated with the transport and processing of lipoproteins in the bloodstream. It plays a significant role in modulating the activity of enzymes such as lipoprotein lipase, influencing triglyceride levels and overall lipid homeostasis. Recent studies have highlighted the relevance of APOC1 in cardiovascular diseases and metabolic disorders, linking genetic variations in the APOC1 gene with increased risks of atherosclerosis and diabetes. The recombinant production of APOC1 protein has garnered attention as it allows for detailed biochemical characterization and functional studies, facilitating insights into its role in lipid metabolism and potential therapeutic applications. Moreover, the ability to produce APOC1 in vitro provides a platform for investigating post-translational modifications and interactions with other proteins involved in lipid transport. Understanding the structure and function of APOC1 at a molecular level can lead to novel strategies for targeting dyslipidemias and related cardiovascular conditions. Thus, the study of recombinant APOC1 protein not only advances our knowledge of lipid metabolism but also holds promise for developing innovative treatments for metabolic diseases.
