Analytical Data
-
Gene name
MLZE
- Application
-
Alternative Names
MLZE；MLZE；Gasdermin-C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BYG8
-
Expression Region
1-508aa
-
AA Sequence
MPSMLERISKNLVKEIGSKDLTPVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSLEFQIVTIPSPNLEDFQKRKLLDPEPSFLKECRRRGDNLYVVTEAVELINNTVLYDSSSVNILGKIALWITYGKGQGQGESLRVKKKALTLQKGMVMAYKRKQLVIKEKAILISDDDEQRTFQDEYEISEMVGYCAARSEGLLPSFHTISPTLFNASSNDMKLKPELFLTQQFLSGHLPKYEQVHILPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDPILYLLEAIMVLSDFQHDLLACSMEKRILLQQQELVRSILEPNFRYPWSIPFTLKPELLAPLQSEGLAITYGLLEECGLRMELDNPRSTWDVEAKMPLSALYGTLSLLQQLAEA
-
Molecular Weight
73.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MLZE (MyoD-like zinc finger protein E) is a member of the zinc finger protein family, which is known for its role in regulating gene expression through binding to specific DNA sequences. The study of MLZE is particularly relevant due to its involvement in various biological processes, including muscle differentiation and development. Researchers have noted that abnormal expression or mutation of MLZE may contribute to several diseases, including muscular dystrophies and other myopathies. A growing body of evidence suggests that MLZE plays a critical role in cellular responses to external stimuli and in modulating signaling pathways that govern cell proliferation and differentiation. The understanding of MLZE’s structural and functional characteristics is crucial for deciphering its mechanisms of action. Consequently, scientists are focusing on characterizing the restructured protein to explore its potential applications in gene therapy and regenerative medicine. By utilizing advanced techniques such as CRISPR gene editing and high-throughput sequencing, researchers aim to uncover the precise roles of MLZE in cellular processes, potentially opening new avenues for therapeutic interventions in muscle-related diseases and beyond.
