Analytical Data
-
Gene name
HIP2
- Application
-
Alternative Names
HIP2；BAP1；DING；HIPI3；E3 ubiquitin-Protein ligase RING2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61086
-
Expression Region
1-200aa
-
AA Sequence
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTP YEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQW AAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAH VYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HIP2, or HMG-box containing protein 2, is a protein that plays a critical role in various cellular processes, including gene regulation and chromatin remodeling. Its significance has attracted attention in the fields of molecular biology and biochemistry due to its potential implications in developmental biology and disease states such as cancer. Research has shown that HIP2 may interact with specific DNA sequences, modulating transcriptional activity and influencing cellular responses to environmental signals. Furthermore, studies suggest that aberrations in HIP2 expression can lead to dysregulation of important signaling pathways, contributing to pathologies. The recombinant expression of HIP2 in various systems allows for the detailed study of its structure-function relationships, interaction partners, and biological activities. This research not only enhances our understanding of HIP2’s fundamental roles but also paves the way for exploring its potential as a therapeutic target. By developing and characterizing HIP2 recombinants, scientists aim to elucidate its mechanisms of action, assess its involvement in various cellular contexts, and ultimately harness its properties for biotechnological applications and clinical interventions.
