Analytical Data
-
Gene name
TIMP3
- Application
-
Alternative Names
TIMP3；MetalloProteinase inhibitor 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35625
-
Expression Region
30-208aa
-
AA Sequence
HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA
-
Molecular Weight
24.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TIMP3 (Tissue Inhibitor of Metalloproteinases 3) is a key regulatory protein that plays a crucial role in extracellular matrix (ECM) remodeling by inhibiting matrix metalloproteinases (MMPs), which are involved in the degradation of ECM components. Dysregulation of TIMP3 has been associated with various pathological conditions, including cancer, cardiovascular diseases, and connective tissue disorders. The recombinant production of TIMP3 facilitates detailed studies of its structure-function relationships and offers potential therapeutic applications. Understanding TIMP3’s inhibitory mechanisms not only provides insights into tissue homeostasis but also highlights its significance in pathological processes. Recent advancements in protein engineering and expression systems have enabled the efficient production of recombinant TIMP3, allowing researchers to investigate its interaction with MMPs and other cellular pathways in depth. The study of TIMP3 as a recombinant protein also opens avenues for the development of innovative therapeutic strategies aimed at restoring normal ECM dynamics in diseased states, thus positioning TIMP3 as a promising target in drug development and regenerative medicine.
