Analytical Data
-
Gene name
CTSK
- Application
-
Alternative Names
CTSK；CTSO；CTSO2；Cathepsin K
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43235
-
Expression Region
115-329aa
-
AA Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
-
Molecular Weight
25.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTSK (Cathepsin K) is a lysosomal cysteine protease predominantly expressed in osteoclasts, the cells responsible for bone resorption. The enzyme plays a critical role in bone metabolism by breaking down collagen and other extracellular matrix proteins, contributing to the maintenance of bone health and homeostasis. Dysregulation of CTSK activity is associated with various bone disorders, including osteoporosis, rheumatoid arthritis, and Paget's disease, where excessive bone resorption leads to weakened bone structure. Due to its pivotal role in osteoclast function and bone remodeling, CTSK has become a significant target for therapeutic interventions aimed at mitigating bone loss. Research into recombinant CTSK (rCTSK) has gained traction in recent years, facilitating investigations into its enzymatic properties, mechanism of action, and potential as a biomarker for bone diseases. The production of rCTSK using recombinant DNA technology allows for the generation of large quantities of the enzyme, enabling detailed studies of its biological functions and interactions with other proteins. Furthermore, by employing rCTSK in preclinical models, researchers are exploring its applications in drug development, including inhibitors that could slow down bone resorption and provide novel treatment options for patients suffering from osteoclast-related diseases. Overall, the study of CTSK and its recombinant form not only enhances our understanding of bone physiology but also holds promise for advancing therapeutic strategies in osteoporosis and other related conditions.
