Cat: PA1000-8668

Recombinant Human DHCR7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DHCR7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DHCR7;D7SR;7-dehydrocholesterol reductase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UBM7

  • Expression Region

    1-475aa

  • AA Sequence

    MAAKLQPNIPKAKSLDGVTNDRTASQGQWGRAWEVDWFSLASVIFLLLFA PFIVYYFIMACDQYSCALTGPVVDIVTGHARLSDIWAKTPPITRKAAQLY TLWVTFQVLLYTSLPDFCHKFLPGYVGGIQEGAVTPAGVVNKYQINGLQA WLLTHLLWFANAHLLSWFSPTIIFDNWIPLLWCANILGYAVSTFAMVKGY FFPTSARDCKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFNGRPGIVAWTL INLSFAAKQRELHSHVTNAMVLVNVLQAIYVIDFFWNETWYLKTIDICHD HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPHAVGVLLLGLVGYYI FRVANHQKDLFRRTDGRCLIWGRKPKVIECSYTSADGQRHHSKLLVSGFW GVARHFNYVGDLMGSLAYCLACGGGHLLPYFYIIYMAILLTHRCLRDEHR CASKYGRDWERYTAAVPYRLLPGIF

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DHCR7 (7-dehydrocholesterol reductase) is an essential enzyme involved in the cholesterol biosynthesis pathway, specifically catalyzing the conversion of 7-dehydrocholesterol to cholesterol. Mutations in the DHCR7 gene are linked to Smith-Lemli-Opitz syndrome (SLOS), a genetic disorder characterized by a range of developmental and physical abnormalities due to impaired cholesterol synthesis. The investigation of DHCR7 and its recombinant protein has gained prominence due to its vital role in cellular membrane integrity and signaling, as well as its implications in developmental biology and disease mechanisms. Researchers are particularly interested in the structure-function relationship of the DHCR7 protein, as understanding its dynamics may provide insights into therapeutic strategies for conditions stemming from cholesterol biosynthesis defects. Furthermore, recombinant DHCR7 can serve as a valuable tool in drug discovery and development, aiding in the creation of compounds that can either mimic its activity or regulate its function. By elucidating the enzymatic activity and regulatory mechanisms of DHCR7 through in vitro studies and structural analysis, scientists hope to uncover potential intervention points for treating SLOS and related cholesterol metabolism disorders. Overall, the study of DHCR7 recombinant protein stands at the intersection of basic biochemistry and clinical application, highlighting the enzyme's significance in both healthy physiology and disease pathology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US