Analytical Data
-
Gene name
USP47
- Application
-
Alternative Names
Deubiquitinating enzyme 47; TFRP; Trf TATA binding Protein related factor proximal homolog; Trf TATA binding Protein related factor proximal homolog Drosophila; Ubiquitin carboxyl-terminal hydrolase 47; Ubiquitin specific peptidase 47; Ubiquitin specific processing protease 47; Ubiquitin specific protease 47; Ubiquitin thioesterase 47; Ubiquitin thiolesterase 47; Ubiquitin-specific-processing protease 47; UBP47_HUMAN; USP47
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96K76
-
Expression Region
1-157 aa
-
AA Sequence
MKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
-
Molecular Weight
44.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
USP47 (Ubiquitin-Specific Protease 47) is a member of the deubiquitinating enzyme family, playing a crucial role in the regulation of protein degradation and various cellular processes by reversing ubiquitination. Ubiquitination is a post-translational modification that typically marks proteins for degradation via the proteasome, while deubiquitinating enzymes like USP47 remove these ubiquitin tags, thereby stabilizing target proteins and influencing diverse signaling pathways, including cell cycle progression, immune responses, and stress responses. Research into USP47 has gained momentum due to its potential implications in cancer biology and neurodegenerative diseases, where dysregulation of ubiquitination pathways is often observed. Studies have demonstrated that USP47 can modulate the stability of key proteins involved in these diseases, making it a promising target for therapeutic intervention. Moreover, the development of recombinant USP47 protein has enabled a better understanding of its enzymatic mechanisms and biological functions. Characterizing the structure and activity of USP47 through recombinant techniques allows researchers to investigate its substrate specificity and interaction with other cellular components, paving the way for the design of small molecule inhibitors or activators that could restore normal ubiquitin signaling in pathological states. Overall, the study of USP47 is essential for unraveling the complex regulatory networks governing protein homeostasis and offers valuable insights into novel therapeutic strategies for diseases associated with ubiquitin system malfunctions.
