Cat: PA1000-8648

Recombinant Human HIST1H2AG Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HIST1H2AG

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HIST1H2AG;H2AFP;HIST1H2AG;H2AC13;Histone H2A type 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0C0S8

  • Expression Region

    2-130aa

  • AA Sequence

    SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

  • Molecular Weight

    18.0kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HIST1H2AG is a gene that encodes a histone protein, specifically a member of the H2A histone family, which plays a crucial role in the packaging and regulation of DNA within the cell nucleus. Its involvement in chromatin structure suggests a significant role in gene expression regulation, DNA repair, and cellular aging. Research has indicated that alterations or mutations in histone proteins can lead to various diseases, including cancers, by influencing chromatin dynamics and accessibility of genomic regions. Moreover, histone modifications and variants, such as those produced by HIST1H2AG, are important for epigenetic regulation, affecting how genes are turned on or off without changing the underlying DNA sequence. Recent studies have aimed to elucidate the functional implications of HIST1H2AG in different biological contexts, including its potential role in tumorigenesis and therapeutic responses. As such, recombinant HIST1H2AG proteins are being utilized in experimental settings to further understand their biochemical properties, interactions with DNA, and overall contribution to cellular processes. This research not only helps in uncovering the fundamental mechanisms of gene regulation but also paves the way for potential therapeutic strategies targeting histone modifications in disease contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US