Analytical Data
-
Gene name
HIST1H2AG
- Application
-
Alternative Names
HIST1H2AG；H2AFP；HIST1H2AG；H2AC13；Histone H2A type 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0C0S8
-
Expression Region
2-130aa
-
AA Sequence
SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
-
Molecular Weight
18.0kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HIST1H2AG is a gene that encodes a histone protein, specifically a member of the H2A histone family, which plays a crucial role in the packaging and regulation of DNA within the cell nucleus. Its involvement in chromatin structure suggests a significant role in gene expression regulation, DNA repair, and cellular aging. Research has indicated that alterations or mutations in histone proteins can lead to various diseases, including cancers, by influencing chromatin dynamics and accessibility of genomic regions. Moreover, histone modifications and variants, such as those produced by HIST1H2AG, are important for epigenetic regulation, affecting how genes are turned on or off without changing the underlying DNA sequence. Recent studies have aimed to elucidate the functional implications of HIST1H2AG in different biological contexts, including its potential role in tumorigenesis and therapeutic responses. As such, recombinant HIST1H2AG proteins are being utilized in experimental settings to further understand their biochemical properties, interactions with DNA, and overall contribution to cellular processes. This research not only helps in uncovering the fundamental mechanisms of gene regulation but also paves the way for potential therapeutic strategies targeting histone modifications in disease contexts.
