Analytical Data
-
Gene name
FLJ22655
- Application
-
Alternative Names
RERGL. FLJ22655. hCG_1651443
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
G5EA41
-
Expression Region
1-205aa
-
AA Sequence
MSNFLHLKYNEKSVSVTKALTVRFLTKRFIGEYASNFESIYKKHLCLERKQLNLEIYDPCSQTQKAKFSLTSELHWADGFVIVYDISDRSSFAFAKALIYRIREPQTSHCKRAVESAVFLVGNKRDLCHVREVGWEEGQKLALENRCQFCELSAAEQSLEVEMMFIRIIKDILINFKLKEKRRPSGSKSMAKLINNVFGKRRKSV
-
Molecular Weight
50.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FLJ22655 is a recombinant protein that has gained attention in biomedical research due to its potential roles in various cellular processes. Emerging evidence suggests that FLJ22655 may be involved in critical pathways related to cell growth, differentiation, and apoptosis. Studies have indicated that this protein could play a significant role in certain disease states, particularly in cancers and metabolic disorders. Its expression patterns in different tissues during various physiological and pathological conditions have prompted investigations into its functional implications. The peculiarity of FLJ22655 lies in its unknown mechanisms, which positions it as a target for further exploration in molecular and cellular biology. Researchers are focused on elucidating its structure-function relationship, signaling pathways, and potential as a biomarker or therapeutic target. Understanding the biological significance of FLJ22655 could lead to novel insights into disease mechanisms and foster the development of innovative treatments. Consequently, ongoing research aims to clarify its role within the broader context of human health and disease, ultimately contributing to advancements in precision medicine.
