Analytical Data
-
Gene name
UGT3A1
- Application
-
Alternative Names
FLJ34658; UD3A1_HUMAN; UDP glycosyltransferase 3 family; polypeptide A1; UDP-glucuronosyltransferase 3A1; UDPGT 3A1; UGT3A 1; Ugt3a1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6NUS8
-
Expression Region
1-523 aa
-
AA Sequence
MVGQRVLLLVAFLLSGVLLSEAAKILTISTLGGSHYLLLDRVSQILQEHGHNVTMLHQSGKFLIPDIKEEEKSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIMDSLKNENYDLVFVEAFDFCSFLIAEKLVKPFVAILPTTFGSLDFGLPSPLSYVPVFPSLLTDHMDFWGRVKNFLMFFSFSRSQWDMQSTFDNTIKEHFPEGSRPVLSHLLLKAELWFVNSDFAFDFARPLLPNTVYIGGLMEKPIKPVPQDLDNFIANFGDAGFVLVAFGSMLNTHQSQEVLKKMHNAFAHLPQGVIWTCQSSHWPRDVHLATNVKIVDWLPQSDLLAHPSIRLFVTHGGQNSVMEAIRHGVPMVGLPVNGDQHGNMVRVVAKNYGVSIRLNQVTADTLTLTMKQVIEDKRYKSAVVAASVILHSQPLSPAQRLVGWIDHILQTGGATHLKPYAFQQPWHEQYLIDVFVFLLGLTLGTMWLCGKLLGVVARWLRGARKVKKT
-
Molecular Weight
85.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UGT3A1 (UDP-glucuronosyltransferase 3A1) is a crucial enzyme involved in the metabolism and detoxification of a wide range of endogenous and exogenous compounds, including drugs, hormones, and environmental toxins. Its primary function is to catalyze the conjugation of glucuronic acid to various substrates, facilitating their excretion and reducing their biological activity. Variations in the UGT3A1 gene can lead to differences in enzyme activity among individuals, influencing the pharmacokinetics and efficacy of certain medications. Research into UGT3A1 has gained traction due to its role in drug metabolism, posing implications for personalized medicine. The recombinant expression of UGT3A1 allows scientists to produce large quantities of the enzyme for functional studies, enabling the investigation of its substrate specificity and the impact of genetic polymorphisms. Understanding the structural and functional aspects of UGT3A1 through recombinant protein studies can provide insights into its regulatory mechanisms and potential interactions with various therapeutic agents, which is vital for developing effective treatment strategies and minimizing adverse drug reactions. Given the increasing complexity of drug formulations and the growing focus on individualized healthcare, the exploration of UGT3A1 remains a significant area of study in pharmacology and toxicology.
