Analytical Data
-
Gene name
UGT3A2
- Application
-
Alternative Names
EC 2.4.1.17; MGC119426; MGC119429; OTTHUMP00000221219; UD3A2_HUMAN; UDP glucuronosyltransferase 3A2; UDP glycosyltransferase 3 family polypeptide A2; UDP-glucuronosyltransferase 3A2; UDPGT 3A2; Ugt3a2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3SY77
-
Expression Region
1-523 aa
-
AA Sequence
MAGQRVLLLVGFLLPGVLLSEAAKILTISTVGGSHYLLMDRVSQILQDHGHNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEETLGGRGKFENLLNVLEYLALQCSHFLNRKDIMDSLKNENFDMVIVETFDYCPFLIAEKLGKPFVAILSTSFGSLEFGLPIPLSYVPVFRSLLTDHMDFWGRVKNFLMFFSFCRRQQHMQSTFDNTIKEHFTEGSRPVLSHLLLKAELWFINSDFAFDFARPLLPNTVYVGGLMEKPIKPVPQDLENFIAKFGDSGFVLVTLGSMVNTCQNPEIFKEMNNAFAHLPQGVIWKCQCSHWPKDVHLAANVKIVDWLPQSDLLAHPSIRLFVTHGGQNSIMEAIQHGVPMVGIPLFGDQPENMVRVEAKKFGVSIQLKKLKAETLALKMKQIMEDKRYKSAAVAASVILRSHPLSPTQRLVGWIDHVLQTGGATHLKPYVFQQPWHEQYLLDVFVFLLGLTLGTLWLCGKLLGMAVWWLRGARKVKET
-
Molecular Weight
85.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UGT3A2, a member of the UDP-glucuronosyltransferase (UGT) family, plays a crucial role in the metabolism of various endogenous and exogenous compounds by catalyzing the glucuronidation process. This enzymatic activity is vital for detoxifying substances, enhancing their solubility, and facilitating their excretion from the body. Research on UGT3A2 has gained importance due to its involvement in drug metabolism, particularly in the context of pharmacogenomics, where genetic variations can influence individual responses to medications. Understanding UGT3A2's structure, function, and polymorphisms is essential for predicting drug efficacy and safety, as certain mutations may lead to altered metabolism and increased risk of adverse drug reactions. Furthermore, UGT3A2 is also implicated in the metabolism of several carcinogens and hormones, leading to growing interest in its potential role in cancer biology and endocrine regulation. The recombinant expression of UGT3A2 allows for detailed studies of its enzymatic kinetics, substrate specificity, and interactions with inhibitors, facilitating a deeper understanding of its biological significance and therapeutic potential. Overall, the study of UGT3A2 is not only pivotal for advancing pharmacotherapy but also for developing personalized medicine approaches that optimize treatment outcomes for diverse patient populations.
