Analytical Data
-
Gene name
ZRSR2
- Application
-
Alternative Names
U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2. CCCH type zinc finger. RNA-binding motif and serine/arginine rich protein 2. Renal carcinoma antigen NY-REN-20. U2(RNU2) small nuclear RNA auxiliary factor 1-like 2. U2AF35-related protein. URP
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15696
-
Expression Region
1-482 aa
-
AA Sequence
MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQKEEEEDTFIEEQQLEEEKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERKLKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNPEPPVDFRVMEKDRANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK
-
Molecular Weight
84.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZRSR2 is a gene that encodes an RNA-binding protein involved in pre-mRNA splicing, playing a crucial role in the regulation of gene expression. Mutations in ZRSR2 have been linked to various hematological malignancies, particularly myelodysplastic syndromes (MDS) and acute myeloid leukemia (AML), highlighting its importance in cancer biology. Research on ZRSR2 recombinant protein has gained attention as it provides insights into the functional mechanisms underlying splicing regulation and its contributions to tumorigenesis. By studying the molecular characteristics and interactions of the ZRSR2 protein, scientists aim to uncover its role in maintaining normal hematopoiesis and how its dysregulation can lead to disease. This knowledge is essential for developing potential therapeutic strategies targeting ZRSR2-related pathways, offering hope for innovative treatments in cancers associated with splicing abnormalities. Furthermore, exploring ZRSR2’s interactions with other spliceosomal components may reveal novel molecular targets for drug development and improve our understanding of the complex network of RNA processing in cellular function and disease progression. Thus, the investigation of ZRSR2 recombinant protein is pivotal for unraveling the intricacies of RNA splicing and its implications in cancer research.
