Analytical Data
-
Gene name
FLJ22595
- Application
-
Alternative Names
ADP ribosylation factor like 14; ADP-ribosylation factor 7; ADP-ribosylation factor-like protein 14; ARF7; ARL14; ARL14_HUMAN; FLJ22595; OTTHUMP00000213879
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N4G2
-
Expression Region
1-192aa
-
AA Sequence
MGSLGSKNPQTKQAQVLLLGLDSAGKSTLLYKLKLAKDITTIPTIGFNVEMIELERNFSLTVWDVGGQEKMRTVWGCYCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKNVPVVLLANKQDMPGALTAEDITRMFKVKKLCSDRNWYVQPCCALTGEGLAQGFRKLTGFVKSHMKSRGDTLAFFKQN
-
Molecular Weight
46.86 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FLJ22595, also known as a recombinant protein, has garnered considerable attention in recent years due to its potential applications in various fields including therapeutics and biotechnology. This protein is encoded by a gene that belongs to a family of proteins involved in critical cellular processes such as signal transduction, metabolism, and cellular response to stress. Research indicates that FLJ22595 exhibits unique structural features and functional properties that may contribute to its biological roles. The recombinant production of this protein allows for detailed studies of its interactions with other biomolecules, paving the way for understanding its mechanism of action. Moreover, insights gained from the study of FLJ22595 could lead to the development of novel therapeutic strategies targeting diseases where its expression is significantly altered. Consequently, the investigation of FLJ22595 is pivotal not only for the elucidation of fundamental biological processes but also for the advancement of medical treatments and biotechnology applications. As such, ongoing research seeks to optimize the production and characterization of FLJ22595, with the goal of harnessing its potential for innovative scientific and clinical applications.
