Analytical Data
-
Gene name
UGT2B4
- Application
-
Alternative Names
UGT2B4; UGT2B11; UDP-glucuronosyltransferase 2B4; UDPGT 2B4; EC 2.4.1.17; HLUG25; Hyodeoxycholic acid-specific UDPGT; UDPGTh-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06133
-
Expression Region
24-492 aa
-
AA Sequence
GKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFNDILRKFCKDIVSNKKLMKKLQESRFDVVLADAVFPFGELLAELLKIPFVYSLRFSPGYAIEKHSGGLLFPPSYVPVVMSELSDQMTFIERVKNMIYVLYFEFWFQIFDMKKWDQFYSEVLGRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTMSSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLD
-
Molecular Weight
60.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UGT2B4, a member of the UDP-glucuronosyltransferase (UGT) enzyme family, plays a crucial role in drug metabolism and the detoxification of various xenobiotics and endogenous compounds. This enzyme is particularly involved in the glucuronidation process, which adds glucuronic acid to lipophilic substances, increasing their water solubility and facilitating renal or biliary excretion. Research on UGT2B4 is essential due to its significant impact on pharmacokinetics, particularly for drugs that undergo extensive metabolism through UGT pathways. Variations in UGT2B4 expression and activity can lead to interindividual differences in drug response, adverse effects, and susceptibility to certain diseases. Additionally, UGT2B4 has been implicated in steroid metabolism, affecting hormone levels and potentially influencing conditions such as hormone-related cancers. Understanding the structure, function, and regulation of UGT2B4 is vital for predicting drug interactions, optimizing therapeutic regimens, and uncovering mechanisms underlying variability in drug metabolism. The production and characterization of recombinant UGT2B4 protein facilitate these investigations, enabling detailed studies on substrate specificity, kinetic parameters, and interactions with pharmacological agents. This background sets the stage for further exploration of UGT2B4's biochemical properties and its implications in personalized medicine and toxicology.
