Analytical Data
-
Gene name
ZPLD1
- Application
-
Alternative Names
Zona pellucida-like domain-containing protein 1. ZP domain-containing protein 1. Cupulin. Cleaved into: Zona pellucida-like domain-containing protein 1. secreted form
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TCW7
-
Expression Region
1-415 aa
-
AA Sequence
MEQIWLLLLLTIRVLPGSAQFNGYNCDANLHSRFPAERDISVYCGVQAITMKINFCTVLFSGYSETDLALNGRHGDSHCRGFINNNTFPAVVIFIINLSTLEGCGNNLVVSTIPGVSAYGNATSVQVGNISGYIDTPDPPTIISYLPGLLYKFSCSYPLEYLVNNTQLASSSAAISVRENNGTFVSTLNLLLYNDSTYNQQLIIPSIGLPLKTKVFAAVQATNLDGRWNVLMDYCYTTPSGSPNDDIRYDLFLSCDKDPQTTVIENGRSQRGRFSFEVFRFVKHKNQKMSTVFLHCVTKLCRADDCPFLMPICSHRERRDAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNAITSALISGMVILGVTSFSLLLCSLALLHRKGPTSLVLNGIRNPVFD
-
Molecular Weight
71.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZPLD1, or Zonula-Peptide Ligand Domain 1, is a protein implicated in various cellular processes, primarily related to cell adhesion and signaling. Recent research has highlighted its potential role in modulating interactions between cells and the extracellular matrix (ECM), which is crucial for tissue development and maintenance. The study of ZPLD1 recombinant proteins has gained attention due to their potential applications in understanding cellular behaviors in disease contexts, such as cancer metastasis and fibrosis. By producing ZPLD1 recombinantly, researchers aim to elucidate its structural characteristics and functional mechanisms, which could provide insights into its involvement in pathological conditions. Additionally, ZPLD1 has been found to influence signaling pathways that govern cell proliferation and migration, making it a focal point for therapeutic exploration. Understanding the precise functions of ZPLD1 could lead to innovative strategies for targeted therapies, improving disease outcomes. As studies continue to unravel the complexities of ZPLD1, it is becoming increasingly clear that this protein could play a vital role in both fundamental biological processes and potential clinical applications.
