Analytical Data
-
Gene name
Ntn4
- Application
-
Alternative Names
Ntn4；Netrin-4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HB63
-
Expression Region
184-395aa
-
AA Sequence
KYSSPFPCTGGEVIFKALSPPYDTENPYSAKVQEQLKITNLRVQLLKRQSCPCQRNDLNEEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPVKAPGTFHMVHGKCMCKHNTAGSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCDDCQHNTEGQYCQRCKPGFYRDLRRPFSAPDACKPC
-
Molecular Weight
58.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ntn4, or netrin-4, is a member of the netrin family of proteins, which are known for their critical roles in guiding neuronal cell migration and axon growth during development. Unlike other netrins that primarily function in the nervous system, Ntn4 has emerged as a significant player in various biological processes, including angiogenesis, cell adhesion, and tissue repair. Recent studies have highlighted its involvement in modulating the extracellular matrix and influencing the behavior of endothelial and neuronal cells. Given its diverse roles, Ntn4 has garnered attention for its potential therapeutic applications, especially in regenerative medicine and cancer therapy. Researchers have focused on producing recombinant Ntn4 protein to better understand its structure-function relationships and to explore its mechanisms of action. The ability to obtain recombinant Ntn4 has enabled detailed investigations into its binding interactions with receptors and other ligands, providing insights into its regulatory functions in cellular environments. Understanding Ntn4's role could lead to innovative strategies for treating neurodegenerative diseases and promoting wound healing, underscoring the importance of continued research on this multifaceted protein.
