Analytical Data
-
Gene name
ZPBP
- Application
-
Alternative Names
Zona pellucida-binding protein 1. Inner acrosomal membrane IAM38. Sp38
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BS86
-
Expression Region
45-351 aa
-
AA Sequence
HLVRLPRAFRLTKDSVKIVGSTSFPVKAYVMLHQKSPHVLCVTQQLRNAELIDPSFQWYGPKGKVVSVENRTAQITSTGSLVFQNFEESMSGIYTCFLEYKPTVEEIVKRLQLKYAIYAYREPHYYYQFTARYHAAPCNSIYNISFEKKLLQILSKLLLDLSCEISLLKSECHRVKMQRAGLQNELFFAFSVSSLDTEKGPKRCTDHNCEPYKRLFKAKNLIERFFNQQVEILGRRAEQLPQIYYIEGTLQMVWINRCFPGYGMNVQQHPKCPECCVICSPGSYNPRDGIHCLQCNSSLVYGAKTCL
-
Molecular Weight
59.51 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZPBP (Zonadhesin-like Protein Binding Protein) is a critical protein that has garnered significant attention in the field of reproductive biology and biochemistry due to its role in gamete recognition and fertilization. Its study is particularly important in understanding the mechanisms of sperm-egg interaction, which is essential for successful fertilization. ZPBP is hypothesized to interact with zona pellucida proteins present on the egg surface, facilitating binding and subsequent fusion of sperm and egg. The exploration of ZPBP encompasses various areas such as molecular biology, genetics, and reproductive technology. This research is vital not only for elucidating the fundamental processes of mammalian reproduction but also for the development of new contraceptives and treatments for infertility. Advances in recombinant protein technology have enabled the production of ZPBP for in-depth functional studies, opening avenues for investigating its structural properties and biological functions. Furthermore, understanding the expression patterns and regulatory mechanisms of ZPBP can provide insights into species-specific fertilization processes and contribute to the understanding of reproductive disorders. As such, ZPBP research represents a significant intersection of basic science and applied reproductive medicine, with implications for both human health and agricultural biotechnology. The ongoing research in this area aims to enhance our knowledge of reproductive mechanisms, paving the way for innovations in fertility treatments and improving reproductive efficiency in livestock.
