Cat: PAX2000-13033

Recombinant Human ZPBP Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ZPBP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Zona pellucida-binding protein 1. Inner acrosomal membrane IAM38. Sp38

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BS86

  • Expression Region

    45-351 aa

  • AA Sequence

    HLVRLPRAFRLTKDSVKIVGSTSFPVKAYVMLHQKSPHVLCVTQQLRNAELIDPSFQWYGPKGKVVSVENRTAQITSTGSLVFQNFEESMSGIYTCFLEYKPTVEEIVKRLQLKYAIYAYREPHYYYQFTARYHAAPCNSIYNISFEKKLLQILSKLLLDLSCEISLLKSECHRVKMQRAGLQNELFFAFSVSSLDTEKGPKRCTDHNCEPYKRLFKAKNLIERFFNQQVEILGRRAEQLPQIYYIEGTLQMVWINRCFPGYGMNVQQHPKCPECCVICSPGSYNPRDGIHCLQCNSSLVYGAKTCL

  • Molecular Weight

    59.51 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ZPBP (Zonadhesin-like Protein Binding Protein) is a critical protein that has garnered significant attention in the field of reproductive biology and biochemistry due to its role in gamete recognition and fertilization. Its study is particularly important in understanding the mechanisms of sperm-egg interaction, which is essential for successful fertilization. ZPBP is hypothesized to interact with zona pellucida proteins present on the egg surface, facilitating binding and subsequent fusion of sperm and egg. The exploration of ZPBP encompasses various areas such as molecular biology, genetics, and reproductive technology. This research is vital not only for elucidating the fundamental processes of mammalian reproduction but also for the development of new contraceptives and treatments for infertility. Advances in recombinant protein technology have enabled the production of ZPBP for in-depth functional studies, opening avenues for investigating its structural properties and biological functions. Furthermore, understanding the expression patterns and regulatory mechanisms of ZPBP can provide insights into species-specific fertilization processes and contribute to the understanding of reproductive disorders. As such, ZPBP research represents a significant intersection of basic science and applied reproductive medicine, with implications for both human health and agricultural biotechnology. The ongoing research in this area aims to enhance our knowledge of reproductive mechanisms, paving the way for innovations in fertility treatments and improving reproductive efficiency in livestock.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US