Analytical Data
-
Gene name
CDKN2A
- Application
-
Alternative Names
CDKN2A；CARF；CDKN2A-interacting Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96HQ2
-
Expression Region
1-116aa
-
AA Sequence
MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS
-
Molecular Weight
17.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDKN2A encodes a tumor suppressor protein that plays a critical role in regulating the cell cycle by inhibiting cyclin-dependent kinases. It is frequently altered in various cancers, particularly melanoma, where mutations or deletions of the CDKN2A gene lead to dysregulation of cell proliferation. Research on CDKN2A recombinant proteins is vital for understanding the mechanisms underlying its tumor suppressive function and the pathogenesis of cancers associated with its alteration. The generation of recombinant CDKN2A proteins allows for detailed biochemical and structural studies, which can elucidate how different mutations impact its function. Additionally, such studies can aid in the development of targeted therapies aimed at restoring the function of the CDKN2A pathway in tumors exhibiting loss of this crucial protein. Investigating the interactions of CDKN2A with other cell cycle regulators and signaling pathways can also provide deeper insights into cancer biology and potential therapeutic targets. Overall, the study of CDKN2A recombinant proteins is a pivotal area of cancer research, offering pathways for innovation in diagnostics and treatment strategies.
