Analytical Data
-
Gene name
ZNF93
- Application
-
Alternative Names
ZNF93; ZNF505; Zinc finger Protein 93; Zinc finger Protein 505; Zinc finger Protein HTF34
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35789
-
Expression Region
1-123 aa
-
AA Sequence
MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRNVMLENYSNLVFLGIVVSKPDLIAHLEQGKKPLTMKRHEMVANPSGARLLSQHFGRPRWVDPEVRRSRPSGQHGEIPSLLKYKKLARHGGPCL
-
Molecular Weight
40.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The ZNF93 gene encodes a zinc finger protein that plays a significant role in various biological processes, including gene regulation, cellular differentiation, and development. Recent studies have suggested that ZNF93 may be involved in important cellular mechanisms, such as transcriptional regulation and chromatin remodeling, which are critical for maintaining cellular homeostasis and responding to environmental stimuli. Abnormalities in the expression or function of ZNF93 have been linked to several diseases, including certain cancers and genetic disorders. Given its potential implications in health and disease, the recombinant expression of ZNF93 protein has become a focal point for researchers aiming to elucidate its biological functions and interactions. By producing and characterizing the ZNF93 protein in a recombinant system, scientists can explore its structural features, binding partners, and functional roles in greater detail. This research not only enhances our understanding of ZNF93's biological significance but also opens avenues for potential therapeutic interventions targeting its pathways. As the demand for precise biological tools increases, the study of ZNF93 and its recombinant protein form is essential for advancing molecular biology and translational medicine.
