Analytical Data
-
Gene name
ZNF92
- Application
-
Alternative Names
HPF12; HTF12; TF12; Zinc finger Protein 92; Zinc finger Protein HTF12; ZNF92; ZNF92_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q03936
-
Expression Region
1-586 aa
-
AA Sequence
MGPLTFRDVKIEFSLEEWQCLDTAQRNLYRDVMLENYRNLVFLGIAVSKPDLITWLEQGKEPWNLKRHEMVDKTPVMCSHFAQDVWPEHSIKDSFQKVILRTYGKYGHENLQLRKDHKSVDACKVYKGGYNGLNQCLTTTDSKIFQCDKYVKVFHKFPNVNRNKIRHTGKKPFKCKNRGKSFCMLSQLTQHKKIHTREYSYKCEECGKAFNWSSTLTKHKIIHTGEKPYKCEECGKAFNRSSNLTKHKIIHTGEKPYKCEECGKAFNRSSTLTKHKRIHTEEKPYKCEECGKAFNQFSILNKHKRIHMEDKPYKCEECGKAFRVFSILKKHKIIHTGEKPYKCEECGKAFNQFSNLTKHKIIHTGEKPYKCDECGKAFNQSSTLTKHKRIHTGEKPYKCEECGKAFKQSSTLTEHKIIHTGEKPYKCEKCGKAFSWSSAFTKHKRNHMEDKPYKCEECGKAFSVFSTLTKHKIIHTREKPYKCEECGKAFNQSSIFTKHKIIHTEGKSYKCEKCGNAFNQSSNLTARKIIYTGEKPYKYEECDKAFNKFSTLITHQIIYTGEKPCKHECGRAFNKSSNYTKEKLQT
-
Molecular Weight
94.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF92, or Zinc Finger Protein 92, is a member of the zinc finger protein family, which plays a crucial role in various biological processes, including gene regulation, cell differentiation, and apoptosis. This protein is characterized by its zinc finger motifs, which facilitate interactions with DNA and other proteins, thus influencing transcriptional activity and cellular functions. Recent studies have suggested that ZNF92 may be involved in processes that govern cellular responses to stress and diseases, including cancer. As researchers have started to explore its therapeutic potential, there is a growing interest in the production and characterization of recombinant ZNF92 proteins. These recombinant forms enable the in-depth exploration of ZNF92’s functional roles, interactions, and mechanisms in various cellular contexts. By employing advanced techniques in molecular biology and protein engineering, scientists aim to establish ZNF92's structural and functional properties, paving the way for future applications in targeted therapies and biomarker development. Understanding the biological significance of ZNF92 through recombinant protein research could illuminate its potential as a therapeutic target or a diagnostic marker in oncology and other diseases.
