Analytical Data
-
Gene name
FLJ10719
- Application
-
Alternative Names
FANCI; FANCI gene; FANCI_HUMAN; Fanconi anemia group I protein; Fanconi anemia; complementation group I; FLJ10719; FLJ14658; KIAA1794; Protein FACI; Protein FANCI
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NVI1
-
Expression Region
1-73aa
-
AA Sequence
MFKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSALDKQHNEEQSGDE
-
Molecular Weight
33.77 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The FLJ10719 protein, also known as C1orf109, has garnered attention in molecular biology and biochemical research due to its potential role in various cellular processes. Initially identified through genomic sequencing projects, FLJ10719 is characterized as a human gene that encodes a protein of unknown function. Recent studies have begun to elucidate its possible involvement in cellular signaling pathways, immune responses, and its implications in disease mechanisms, particularly in cancer and autoimmune disorders. The protein's expression patterns, cellular localization, and interaction with other biomolecules have been subjects of investigation, revealing insights into its functional significance. Further research could unlock its potential as a biomarker for disease states or therapeutic target. Understanding FLJ10719 is crucial, as it may contribute to the broader understanding of human health and disease, underscoring the importance of ongoing investigations into its biological roles and mechanisms of action.
