Cat: PA2000-7685

Recombinant Human FLJ10618 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FLJ10618

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SLC25A36; Solute carrier family 25 member 36

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96CQ1

  • Expression Region

    1-311aa

  • AA Sequence

    MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASYAGISETVIHFVIYESIKQKLLEYKTASTMENDEESVKEASDFVGMMLAAATSKTCATTIAYPHEVVRTRLREEGTKYRSFFQTLSLLVQEEGYGSLYRGLTTHLVRQIPNTAIMMATYELVVYLLNG

  • Molecular Weight

    59.95 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FLJ10618, identified as a recombinant protein, has garnered attention in the field of molecular biology and biotechnology due to its potential implications in various therapeutic applications. Initially, its gene was isolated and characterized from human cDNA libraries, providing insights into its unique structural and functional properties. The protein's expression patterns and functional roles remain under investigation, particularly in relation to its involvement in cell signaling pathways and disease mechanisms. Research suggests that FLJ10618 may play critical roles in cellular processes such as proliferation, differentiation, and apoptosis, potentially linking it to conditions like cancer and metabolic disorders. Its recombinant form allows for extensive study, enabling researchers to explore the protein's interactions with other biomolecules, assess its stability, and evaluate its efficacy as a therapeutic agent. Recent advancements in recombinant protein technologies have facilitated the production of FLJ10618 in various host systems, which further enhances its potential for biomedical applications. Ongoing studies are focused on elucidating its biological functions, determining its molecular interactions, and exploring its viability as a drug target or therapeutic conjugate, thereby expanding the understanding of its role in health and disease. As research progresses, FLJ10618 not only promises to contribute significantly to the current knowledge of protein function but also represents a potential frontier for innovative approaches in personalized medicine and targeted therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US