Analytical Data
-
Gene name
ZNF81
- Application
-
Alternative Names
ZNF81Zinc finger Protein 81; HFZ20
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51508
-
Expression Region
1-122 aa
-
AA Sequence
MPANEDAPQPGEHGSACEVSVSFEDVTVDFSREEWQQLDSTQRRLYQDVMLENYSHLLSVGFEVPKPEVIFKLEQGEGPWTLEGEAPHQSCSDGKFGIKPSQRRISGKSTFHSEMEGEDTLC
-
Molecular Weight
40.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF81 (Zinc Finger Protein 81) is a member of the zinc finger protein family, which plays critical roles in various biological processes, including gene regulation, cell differentiation, and development. Research on ZNF81 has gained attention due to its potential implications in cancer biology and developmental disorders. It is known to function as a transcription factor, binding to specific DNA sequences and influencing the expression of target genes involved in cellular proliferation and survival. Studies have indicated that ZNF81 may be dysregulated in certain malignancies, suggesting its involvement in oncogenic pathways. Moreover, its role in neural development and the maintenance of pluripotency has opened avenues for exploring ZNF81 in regenerative medicine. To further understand the functional mechanisms of ZNF81 and its interactions with other cellular components, researchers have increasingly focused on the production and characterization of recombinant ZNF81 protein. This recombinant protein serves as a valuable tool for biochemical assays, structural studies, and in vivo experiments aimed at elucidating the downstream effects of ZNF81 activity. The successful expression and purification of ZNF81 as a recombinant protein facilitate the exploration of its molecular functions and potential as a therapeutic target in related diseases, paving the way for future studies dedicated to harnessing its biological significance.
