Analytical Data
-
Gene name
FMO1
- Application
-
Alternative Names
FMO1；Flavin-containing monooxygenase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01740
-
Expression Region
1-532aa
-
AA Sequence
MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVSNSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWFGLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGKWEGARNAIMTQWDRTFKVIKARVVQESPSPFESFLKVFSFLALLVAIFLIFL
-
Molecular Weight
60.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FMO1, or flavin-containing monooxygenase 1, is an important enzyme involved in the oxidative metabolism of various endogenous and exogenous compounds, including drugs and environmental toxins. This enzyme, which catalyzes the oxidation of nucleophilic nitrogen, sulfur, and carbon centers, plays a critical role in determining the pharmacokinetics and toxicology of many therapeutic agents. Understanding FMO1’s functionality and structure is essential for drug development, as variations in FMO1 expression and activity can lead to significant differences in drug efficacy and safety profiles among individuals. Additionally, FMO1 is implicated in various physiological processes, including the metabolism of neurotransmitters and the detoxification of xenobiotics. Recent studies utilizing recombinant FMO1 proteins have provided insights into the enzyme's substrate specificity and mechanisms of action, elucidating how genetic polymorphisms influence metabolism. The characterization of FMO1 through recombinant DNA technology allows for the production of active protein variants, enabling extensive biochemical analyses and the identification of potential drug interactions. Given the increasing importance of personalized medicine, the study of FMO1’s role in drug metabolism presents opportunities to tailor therapeutic strategies to individual metabolic profiles, thereby enhancing treatment outcomes and minimizing adverse effects.
