Analytical Data
-
Gene name
FKSG44
- Application
-
Alternative Names
FERM domain containing 8; FERM domain containing protein 8; FERM domain-containing protein 8; FKSG44; FLJ32216; FLJ90369; Frmd8; FRMD8_HUMAN; MGC31785
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BZ67
-
Expression Region
1-464aa
-
AA Sequence
MDGTEGSAGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRAVREVLQLPDIALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVAMDEPFLQFRRNVFFPKRRELQIHDEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVCRVQLGPYQPGRPAACDLREKLDSFLPAHLCKRGQSLFAALRGRGARAGPGEQGLLNAYRQVQEVSSDGGCEAALGTHYRAYLLKCHELPFYGCAFFHGEVDKPAQGFLHRGGRKPVSVAISLEGVHVIDSREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVEDGKGIRRVKPKRTTSFFSRQLSLGQGSYTVVQPGDSLEQG
-
Molecular Weight
77.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The FKSG44 recombinant protein is a significant focus in the field of molecular biology and biotechnology due to its potential applications in therapeutic development and protein engineering. Originally derived from the FK506-binding protein family, FKSG44 possesses unique structural and functional characteristics that make it an appealing subject for study. Research has shown that this protein plays a crucial role in cellular processes such as signal transduction, protein folding, and immune response modulation. The ability to produce FKSG44 as a recombinant protein allows for detailed analysis of its biochemical properties and interactions with other molecules, which is essential for understanding its physiological roles. Furthermore, given the increasing interest in targeted therapies and biologics, FKSG44 could have implications in developing drugs for diseases where dysregulation of its pathways is observed, such as autoimmune disorders and cancers. As scientists explore the functional dynamics of FKSG44, they also investigate methods to enhance its stability and efficacy, paving the way for innovative therapeutic strategies and novel biotechnological applications. Overall, the study of FKSG44 recombinant protein stands at the intersection of fundamental research and practical applications, highlighting its importance in advancing scientific knowledge and improving human health.
