Analytical Data
-
Gene name
ZNF75
- Application
-
Alternative Names
Zinc finger Protein 75D. Zinc finger Protein 75. Zinc finger Protein 82
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51815
-
Expression Region
1-510 aa
-
AA Sequence
MAMRELNADSCSSPQMGAMWETSGSVKENSSQSKKYSTKIENLGPESACRHFWSFRYHEATGPLETISQLQKLCHQWLRPEIHSKEQILEMLVLEQFLSILPKETQNWVQKHHPQNVKQALVLVEFLQREPDGTKNEVTAHELGKEAVLLGGTAVAPGFKWKPAEPQPMGVFQKEYWNTYRVLQEQLGWNTHKETQPVYERAVHDQQMLALSEQKRIKHWKMASKLILPESLSLLTFEDVAVYFSEEEWQLLNPLEKTLYNDVMQDIYETVISLGLKLKNDTGNDHPISVSTSEIQTSGCEVSKKTRMKIAQKTMGRENPGDTHSVQKWHRAFPRKKRKKPATCKQELPKLMDLHGKGPTGEKPFKCQECGKSFRVSSDLIKHHRIHTGEKPYKCQQCDRRFRWSSDLNKHFMTHQGIKPYRCSWCGKSFSHNTNLHTHQRIHTGEKPFKCDECGKRFIQNSHLIKHQRTHTGEQPYTCSLCKRNFSRRSSLLRHQKLHRRREACLVSPN
-
Molecular Weight
85.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF75 (Zinc Finger Protein 75) is a member of the zinc finger protein family, which plays a pivotal role in various biological processes, including transcriptional regulation, DNA repair, and cell differentiation. Research on ZNF75 has gained momentum due to its potential implications in cancer biology and developmental disorders. Several studies have linked abnormal expression or mutations of ZNF75 to tumorigenesis, highlighting its role as a potential oncogene or tumor suppressor in specific contexts. Moreover, the protein's interaction with other cellular components further underscores its importance in cellular signaling pathways. To elucidate the functional mechanisms underlying ZNF75's activities, researchers often employ recombinant protein techniques to generate and characterize ZNF75 variants. These studies facilitate the exploration of ZNF75's binding affinities to DNA sequences and its influence on the expression of target genes. Understanding the structure-function relationship of ZNF75 through recombinant protein approaches not only enhances our knowledge of its biological significance but may also pave the way for therapeutic strategies in cancer treatment and genetic research.
