Analytical Data
-
Gene name
ZNF740
- Application
-
Alternative Names
ZNF740; TB7Zinc finger Protein 740; OriLyt TD-element-binding Protein 7
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NDX6
-
Expression Region
1-193 aa
-
AA Sequence
MAQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSDKSRSRKDDDSLSEASHSKKTVKKVVVVEQNGSFQVKIPKNFVCEHCFGAFRSSYHLKRHILIHTGEKPFECDICDMRFIQKYHLERHKRVHSGEKPYQCERCHQCFSRTDRLLRHKRMCQGCQSKTSDGQFSL
-
Molecular Weight
48.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF740, a member of the zinc finger protein family, has garnered significant attention in recent years due to its potential roles in gene regulation and cellular processes. Research indicates that ZNF740 may function as a transcription factor, modulating the expression of target genes involved in various biological pathways, including development, differentiation, and responses to external stimuli. Studies have linked ZNF740 to processes such as cellular stress response and apoptosis, highlighting its relevance in cancer biology and other diseases. The reconstitution of ZNF740 as a recombinant protein is critical for elucidating its structure-function relationships and for conducting functional assays to determine its specific biological roles. By producing ZNF740 in a controlled, recombinant system, researchers can explore its interactions with other cellular proteins, DNA, and RNA, thereby advancing our understanding of its mechanism of action. This research is pivotal in assessing its potential as a therapeutic target and in developing novel strategies for disease intervention, particularly in cancer, where aberrant expression of zinc finger proteins has been implicated. Furthermore, insights gained from studying ZNF740 can contribute to the broader understanding of zinc finger proteins and their significance in eukaryotic gene regulation. As such, the investigation of ZNF740 as a recombinant protein represents a crucial step in unveiling its biological significance and potential applications in biotechnology and medicine.
