Analytical Data
-
Gene name
ZNF71
- Application
-
Alternative Names
ZNF71; EZFITEndothelial zinc finger Protein induced by tumor necrosis factor alpha; Zinc finger Protein 71
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NQZ8
-
Expression Region
1-489 aa
-
AA Sequence
MKELDPKNDISEDKLSVVGEATGGPTRNGARGPGSEGVWEPGSWPERPRGDAGAEWEPLGIPQGNKLLGGSVPACHELKAFANQGCVLVPPRLDDPTEKGACPPVRRGKNFSSTSDLSKPPMPCEEKKTYDCSECGKAFSRSSSLIKHQRIHTGEKPFECDTCGKHFIERSSLTIHQRVHTGEKPYACGDCGKAFSQRMNLTVHQRTHTGEKPYVCDVCGKAFRKTSSLTQHERIHTGEKPYACGDCGKAFSQNMHLIVHQRTHTGEKPYVCPECGRAFSQNMHLTEHQRTHTGEKPYACKECGKAFNKSSSLTLHQRNHTGEKPYVCGECGKAFSQSSYLIQHQRFHIGVKPFECSECGKAFSKNSSLTQHQRIHTGEKPYECYICKKHFTGRSSLIVHQIVHTGEKPYVCGECGKAFSQSAYLIEHQRIHTGEKPYRCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRIHT
-
Molecular Weight
80.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF71 (Zinc Finger Protein 71) is a member of the zinc finger protein family, which plays a crucial role in gene regulation and has been implicated in various biological processes, including development, cell differentiation, and apoptosis. Research on ZNF71 has gained momentum due to its potential involvement in human diseases, particularly in cancer and genetic disorders. The unique structural characteristics of ZNF71, particularly its zinc finger domains, allow for precise binding to specific DNA sequences, making it a key player in transcriptional regulation. Understanding the functional mechanisms of ZNF71 and its interactions with other proteins can provide insights into the regulation of gene expression and the pathways involved in disease progression. The production of recombinant ZNF71 in vitro allows for detailed studies of its biochemical properties, interaction networks, and therapeutic potential. Moreover, this research contributes to the development of novel strategies for gene therapy and the design of targeted treatments. As such, ZNF71 has emerged as a significant focus of investigation in molecular biology and biotechnology, making it a promising candidate for further research into its roles in health and disease.
