Analytical Data
-
Gene name
TUSC3
- Application
-
Alternative Names
TUSC3; N33; Tumor suppressor candidate 3; Dolichyl-diphosphooligosaccharide--Protein glycosyltransferase subunit TUSC3; Oligosaccharyl transferase subunit TUSC3; Magnesium uptake/transporter TUSC3; Protein N33
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13454
-
Expression Region
1-347 aa
-
AA Sequence
MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSFLIK
-
Molecular Weight
66 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TUSC3, or Tumor Suppressor Candidate 3, is a protein encoded by the TUSC3 gene, which has garnered attention due to its potential role in tumor suppression and its involvement in various cellular processes, including protein translation and glycosylation. Research indicates that TUSC3 is essential for maintaining normal cellular functions, and its loss or mutation has been linked to several malignancies, notably breast and colorectal cancers. Studies have shown that TUSC3 interacts with ribosomal components and is critical for the proper folding and modification of glycoproteins, thereby influencing the stability and functionality of membrane proteins. Furthermore, TUSC3's role in the endoplasmic reticulum (ER) suggests it could be a key player in the stress response of cancer cells, potentially contributing to their survival and proliferation under adverse conditions. As such, understanding the structure and function of TUSC3, including the implications of its recombination into functional proteins, is vital for elucidating its mechanisms in cancer biology. This research not only sheds light on TUSC3's role in tumorigenesis but also opens avenues for therapeutic interventions, including the development of TUSC3-targeted treatments or strategies to restore its function in cancerous cells, highlighting TUSC3 as an important focus in oncological research.
