Analytical Data
-
Gene name
FBXW11
- Application
-
Alternative Names
(F-box and WD repeats protein beta-TrCP2)(F-box/WD repeat-containing protein 1B)(Homologous to Slimb protein)(HOS)
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UKB1
-
Expression Region
1-542aa
-
AA Sequence
MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR
-
Molecular Weight
69.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FBXW11, a member of the F-box protein family, is implicated in the ubiquitin-proteasome system, which is crucial for regulating various cellular processes, including protein degradation, cell cycle progression, and signal transduction. The role of FBXW11 as a substrate recognition component in E3 ubiquitin ligases has garnered significant interest, particularly in the context of cancer and developmental disorders. Studies have shown that FBXW11 is involved in the ubiquitination of key regulatory proteins, influencing their stability and function. Moreover, mutations and dysregulation of FBXW11 have been linked to various malignancies, underscoring its potential as a biomarker for cancer diagnosis and prognosis. This research aims to elucidate the molecular mechanisms underlying FBXW11's function and its interactions with various substrates, which could pave the way for novel therapeutic strategies targeting the ubiquitin-proteasome pathway in disease treatment. Enhanced understanding of FBXW11 could potentially lead to improved strategies for manipulating protein degradation pathways and advancing cancer treatments or other therapies related to its dysregulation.
