Cat: PA1000-8517

Recombinant Human NFIX Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NFIX

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NFIX;Nuclear factor 1 X-type

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14938-3

  • Expression Region

    1-441aa

  • AA Sequence

    MYSPYCLTQDEFHPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSK DEERAVKDELLGEKPEIKQKWASRLLAKLRKDIRPEFREDYVLTITGKKP PCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERL YKSPQCSNPGLCVQPHHIGVTIKELDLYLAYFVHTPESGQSDSSNQQGDA DIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLES PSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGR SPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHP LPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSL KEFVQFVCSDGSGQATGQHSQRQAPPLPTGLSASDPGTATF

  • Molecular Weight

    74 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NFIX (Nuclear Factor I X) is a transcription factor belonging to the Nuclear Factor I (NFI) family, which plays a crucial role in various biological processes, including cell differentiation, proliferation, and development. Research on NFIX has garnered significant attention due to its involvement in essential cellular functions and its implications in various diseases, including cancer and neurological disorders. The study of NFIX recombinant proteins has been instrumental in elucidating its functional characteristics and regulatory mechanisms. By expressing NFIX in a recombinant form, researchers can investigate its interactions with other proteins, DNA, and various signaling pathways. The ability to produce NFIX as a fusion protein with tags has facilitated the purification and characterization of this protein, allowing for detailed studies on its structural and functional properties. Moreover, understanding the role of NFIX in gene expression regulation can provide insights into developmental processes and potential therapeutic targets for diseases associated with NFIX dysregulation. The ongoing research into NFIX recombination not only advances our knowledge of its biological roles but also opens avenues for developing novel therapeutic strategies in regenerative medicine and cancer treatment. As NFIX continues to be a focal point of investigation, the exploration of its recombinant variants may uncover new dimensions of its function and regulation in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US