Analytical Data
-
Gene name
ZNF639
- Application
-
Alternative Names
6230400O18Rik; ANC 2H01; ANC_2H01; MGC157200; OTTHUMP00000212173; OTTHUMP00000212174; OTTHUMP00000212175; OTTHUMP00000212195; OTTHUMP00000212197; ZASC1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UID6
-
Expression Region
1-485 aa
-
AA Sequence
MNEYPKKRKRKTLHPSRYSDSSGISRIADGFNGIFSDHCYSVCSMRQPDLKYFDNKDDDSDTETSNDLPKFADGIKARNRNQNYLVPSPVLRILDHTAFSTEKSADIVICDEECDSPESVNQQTQEESPIEVHTAEDVPIAVEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKILDKSQALNVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQHMILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIADTHFSDHLYWCEQCDVQFSSSSELYLHFQEHSCDEQYLCQFCEHETNDPEDLHSHVVNEHACKLIELSDKYNNGEHGQYSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTKIFPHVCDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQIEDLKIHLDFKHSADLPHKCSDCLMRFGNERELISHLPVHETT
-
Molecular Weight
82.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF639, a member of the zinc finger protein family, has garnered significant attention in recent years due to its potential roles in various biological processes, including transcriptional regulation and cellular signaling. This protein is characterized by its unique structure, which enables it to interact with DNA and other proteins, influencing gene expression and cellular functions. Research has indicated that ZNF639 may play a pivotal role in development, cell differentiation, and the immune response. Moreover, aberrations in ZNF639 expression or function have been linked to several diseases, including cancers and autoimmune disorders. The recombinant form of ZNF639 is often produced to facilitate in-depth studies, allowing researchers to explore its biochemical properties, interaction networks, and functional implications in a controlled environment. Understanding ZNF639's mechanisms can provide insights into its contributions to disease pathology and reveal potential therapeutic targets. Thus, the study of recombinant ZNF639 holds promise in advancing our knowledge of gene regulation and its implications for health and disease.
