Analytical Data
-
Gene name
NUMA1
- Application
-
Alternative Names
NUMA1；NMP22；NUMA；Nuclear mitotic apparatus Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14980
-
Expression Region
200-306aa
-
AA Sequence
SPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDA QIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQC QDLKTEK
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NUMA1 (Nuclear mitotic apparatus protein 1) is a crucial protein involved in the regulation of mitosis, specifically in the organization and positioning of the mitotic spindle. Its improper function is linked to various cellular processes, including cell division, apoptosis, and the maintenance of chromosomal integrity. Research has shown that NUMA1 interacts with various cellular components, such as microtubules and other spindle-related proteins, playing a vital role in ensuring accurate chromosome segregation during cell division. Dysregulation of NUMA1 expression or function has been implicated in several cancers, making it a significant focus for cancer research. Studies have reported that overexpression of NUMA1 can lead to tumor development and progression, while loss of function can result in genomic instability. Understanding the molecular mechanisms by which NUMA1 operates, as well as its potential as a therapeutic target, is of paramount importance. Advances in recombinant protein technology have facilitated the detailed study of NUMA1, allowing researchers to analyze its structure, function, and interactions within the cell. Through the production of recombinant NUMA1, scientists can investigate its roles in cell cycle regulation and explore potential applications in targeted therapies, aiming to manipulate its function for therapeutic benefit in cancer treatment and other diseases associated with cell division errors.
