Analytical Data
-
Gene name
BMP3
- Application
-
Alternative Names
BMP3；BMP3A；Bone morphogenetic Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12645
-
Expression Region
363-472aa
-
AA Sequence
QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
-
Molecular Weight
13.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Bone Morphogenetic Protein 3 (BMP3) is a member of the transforming growth factor-beta (TGF-β) superfamily, which plays a crucial role in bone and cartilage development. Initially discovered for its ability to induce bone formation, BMP3's function has evolved into a deeper understanding of its regulatory roles in various biological processes, including cell differentiation, proliferation, and apoptosis. Research has indicated that BMP3 acts as an antagonist to other BMPs, participating in the complex signaling pathways that govern skeletal homeostasis and development. The recombinant expression of BMP3 has been a focal point in regenerative medicine, as it holds potential for therapeutic applications in bone repair and osteoporosis treatment. Furthermore, studies have revealed that BMP3 is implicated in modulating inflammatory responses and may influence the progression of certain cancers. As a result, the generation and characterization of BMP3 recombinant proteins are pivotal for elucidating its diverse physiological functions and unlocking its therapeutic potential. Understanding the structure-function relationship of BMP3 could lead to innovative solutions for skeletal disorders and other diseases where BMP signaling is dysregulated.
