Cat: PA1000-8501

Recombinant Human BMP3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BMP3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BMP3;BMP3A;Bone morphogenetic Protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P12645

  • Expression Region

    363-472aa

  • AA Sequence

    QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

  • Molecular Weight

    13.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Bone Morphogenetic Protein 3 (BMP3) is a member of the transforming growth factor-beta (TGF-β) superfamily, which plays a crucial role in bone and cartilage development. Initially discovered for its ability to induce bone formation, BMP3's function has evolved into a deeper understanding of its regulatory roles in various biological processes, including cell differentiation, proliferation, and apoptosis. Research has indicated that BMP3 acts as an antagonist to other BMPs, participating in the complex signaling pathways that govern skeletal homeostasis and development. The recombinant expression of BMP3 has been a focal point in regenerative medicine, as it holds potential for therapeutic applications in bone repair and osteoporosis treatment. Furthermore, studies have revealed that BMP3 is implicated in modulating inflammatory responses and may influence the progression of certain cancers. As a result, the generation and characterization of BMP3 recombinant proteins are pivotal for elucidating its diverse physiological functions and unlocking its therapeutic potential. Understanding the structure-function relationship of BMP3 could lead to innovative solutions for skeletal disorders and other diseases where BMP signaling is dysregulated.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US